PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000002.1_g00068.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 298aa    MW: 33517.7 Da    PI: 6.0402
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000002.1_g00068.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.63.5e-55131391129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL +k  +  +++  +i evd+++vePwdLp +++ +ekewyfF+ rd+ky+tg r+nrat+sgyWkat
  Itr_sc000002.1_g00068.1  13 LPPGFRFHPTDEELITHYLSPKSLNAAFSA-VAIGEVDLNRVEPWDLPWRARMGEKEWYFFCVRDRKYPTGMRTNRATESGYWKAT 97 
                              79*************************999.67***************8888999******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++  ++lvg+kktLvfy+grap+ge+t+Wvmheyrle
  Itr_sc000002.1_g00068.1  98 GKDKEIFT-AKTLVGMKKTLVFYSGRAPRGERTNWVMHEYRLE 139
                              ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-638157IPR003441NAC domain
PROSITE profilePS5100559.44113157IPR003441NAC domain
PfamPF023658.4E-3014138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MENPCVFDDE MNLPPGFRFH PTDEELITHY LSPKSLNAAF SAVAIGEVDL NRVEPWDLPW  60
RARMGEKEWY FFCVRDRKYP TGMRTNRATE SGYWKATGKD KEIFTAKTLV GMKKTLVFYS  120
GRAPRGERTN WVMHEYRLEG HHQTFQTEWV ICRIFKKTAG GKKIHISALI RGGGDGSNNS  180
TPSSLPPLTD ISQTTYFSDS ADDQKPIMMA SSFASSPSPS KNSDVSPAPL IFPADPTPAT  240
YFHSDQIIPY GADNMDFSDS GMTQDHSVPR FLHPYEEQAF LMTSAASGPV DIGCLWDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-561016317174NAC domain-containing protein 19
3swp_C1e-561016317174NAC domain-containing protein 19
3swp_B1e-561016317174NAC domain-containing protein 19
3swp_A1e-561016317174NAC domain-containing protein 19
3swm_D1e-561016317174NAC domain-containing protein 19
3swm_C1e-561016317174NAC domain-containing protein 19
3swm_B1e-561016317174NAC domain-containing protein 19
3swm_A1e-561016317174NAC domain-containing protein 19
4dul_B2e-561016314171NAC domain-containing protein 19
4dul_A2e-561016314171NAC domain-containing protein 19
1ut7_B2e-561016314171NO APICAL MERISTEM PROTEIN
1ut7_A2e-561016314171NO APICAL MERISTEM PROTEIN
1ut4_B2e-561016314171NO APICAL MERISTEM PROTEIN
1ut4_A2e-561016314171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561385.11e-117PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLJ22e-99NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A068U1T71e-116A0A068U1T7_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000033801e-113(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-96NAC domain containing protein 100